Scaffold Ga0272446_1002262

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0272446_1002262

Scaffold Ga0272446_1002262

Overview

Basic Information
Taxon OID	3300028735 Open in IMG/M
Scaffold ID	Ga0272446_1002262 Open in IMG/M
Source Dataset Name	Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-006-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	26525
Total Scaffold Genes	34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	28 (82.35%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5772	Long. (^o)	-110.7892	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007172	Metagenome / Metatranscriptome	356	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272446_100226216	F007172	AGGAGG	MITMTTMQRRALAAALRAAKQDAYCKQVGGFAVARMSDGTIDWFPFGQPPHRHGEPDRGAVILAKWRWNHRRWSRIA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.