Scaffold Ga0307319_10117400

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307319_10117400

Scaffold Ga0307319_10117400

Overview

Basic Information
Taxon OID	3300028722 Open in IMG/M
Scaffold ID	Ga0307319_10117400 Open in IMG/M
Source Dataset Name	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	856
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location Name	USA: Colorado
Coordinates	Lat. (^o)	38.9206	Long. (^o)	-106.9489	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003271	Metagenome	496	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307319_101174001	F003271	AGGTGG	MAGLWDLLGWPGLTAAEQACAVTGAATGLAAALLARALFGGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.