Scaffold Ga0309993_1506

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0309993_1506

Scaffold Ga0309993_1506

Overview

Basic Information
Taxon OID	3300028663 Open in IMG/M
Scaffold ID	Ga0309993_1506 Open in IMG/M
Source Dataset Name	Enriched hypersaline water microbial communities from Club Lake, Antarctica - Round 1 Nha-Ce
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Garvan Institute of Medical Research
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4718
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Antarctic Nanohaloarchaea

Source Dataset Sampling Location
Location Name	Club Lake, Antarctica
Coordinates	Lat. (^o)	-68.5417	Long. (^o)	78.2467	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003128	Metagenome	506	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0309993_15061	F003128	N/A	RRRGTLRMQIEVSASEIKAAKKADDRGRVTLGSEYAGKAVTVAVLEVEDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.