Scaffold Ga0268299_1004671

Overview

Basic Information

• Taxon OID: 3300028648
• Scaffold ID: Ga0268299_1004671
• Source Dataset Name: Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10344
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050594	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268299_10046712	F050594	N/A	MSRITFDRSLYAPDAVAAAATAYADYADITLETANDAVVADVGAVRGADRDTVEHSFCNLVLQETVVRLRRTAAESGGTE