| Basic Information | |
|---|---|
| Taxon OID | 3300028627 Open in IMG/M |
| Scaffold ID | Ga0302243_1090640 Open in IMG/M |
| Source Dataset Name | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 593 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 44.11 | Long. (o) | -88.23 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018746 | Metagenome / Metatranscriptome | 233 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302243_10906401 | F018746 | GGAG | MRPTSETLNDFEAAVLAALEQTPDRPILAADLVRTFSTRVGRTSCISRLERMERRGLVRTSRFAGRI |
| ⦗Top⦘ |