NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302251_1002611

Scaffold Ga0302251_1002611


Overview

Basic Information
Taxon OID3300028625 Open in IMG/M
Scaffold IDGa0302251_1002611 Open in IMG/M
Source Dataset NameEnriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Gln
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8552
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065806Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0302251_100261118F065806N/AIFLTAGSSCVCWGYAHDESTWGYAGKIYDWTGNKQKIVSIGESVSGGAARNRVYFYGGYTQDNTAEADGGTGKCLQFNPKNASYWIEQDFNVPVTSGVARTVSIKMKDDASFDGTVELELWYKGVLIVGPTAKTMTTSYVAQEMTAAAGDIDADGVLVLKVKVYGTAGAVYADTLTYS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.