NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302251_1001787

Scaffold Ga0302251_1001787


Overview

Basic Information
Taxon OID3300028625 Open in IMG/M
Scaffold IDGa0302251_1001787 Open in IMG/M
Source Dataset NameEnriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Gln
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11913
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076867Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0302251_10017879F076867GGAMDEKNRNLVEIAKKKRYIALVEKLGRGSLSSKELKELEEFEKSEQRPAGVIDGTVDLPTLCVYLEKSPRMIRRYVQQGMPVFRDAAGEIARFKVGDVFKWFYVKQGSEEDNGKDYWDKEYRKNRAKLSEIELKQKEGEVIPFEDHVSIVKNQIRGIKAGFLRLPKHVAPKLYQQDPKVICEMLDQEIRYIIEQFAGKKNANKDGKGNT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.