NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302246_1003944

Scaffold Ga0302246_1003944


Overview

Basic Information
Taxon OID3300028624 Open in IMG/M
Scaffold IDGa0302246_1003944 Open in IMG/M
Source Dataset NameEnriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7608
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009968Metagenome / Metatranscriptome310Y
F011593Metagenome / Metatranscriptome289Y
F051949Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0302246_100394410F051949GGAGGMFAHAGTARLDIFTDSLLLEVGEDLFLARLSRLSPLMQGRAAYCPLSRRYQGTAGHYCDVEQGIGLRRSKPGAALILIDRGTIYSIPVVELREVLHGVRSECGISRVLTTEARMMEVEA
Ga0302246_10039446F011593GGCGGVTDNLAAPAWCLGCSHPIYDGRRGEWDWYCRQWSPTGILCTNVAVLRERCYRVREYFARKEAST
Ga0302246_10039448F009968AGGMNTCLGCRSHYRERHWWIFEIDFCGLTGDVVGFECPIGCIDTEGCPAYERRPAWPEGAIA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.