Basic Information | |
---|---|
Taxon OID | 3300028603 Open in IMG/M |
Scaffold ID | Ga0265293_10616447 Open in IMG/M |
Source Dataset Name | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 599 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Waterloo, Ontario | |||||||
Coordinates | Lat. (o) | 43.442 | Long. (o) | -80.577 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022996 | Metagenome | 212 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265293_106164471 | F022996 | N/A | METIVKTNISKMKSDIKKMVELQKFYKNQRKTENLVGERKMSPSEATWKHTTNREDLRIMYAAYGLARGKSFSQIENKYPENNHPLKNYQHSID |
⦗Top⦘ |