| Basic Information | |
|---|---|
| Taxon OID | 3300028600 Open in IMG/M |
| Scaffold ID | Ga0265303_10826844 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 761 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Candidatus Nitrosopumilus sp. SW | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: North Sea, Helgoland | |||||||
| Coordinates | Lat. (o) | 54.1817 | Long. (o) | 7.9018 | Alt. (m) | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013764 | Metagenome | 268 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265303_108268442 | F013764 | GAG | MIQTPSFFFFRTNPKKNTSNSSLPPYLKRALIAVSVAIPMTFGLNISLNTFGTFMPVWAIIMINAIVIPSYMTFIIPKASKVFASWLNSTTVKGLN |
| ⦗Top⦘ |