| Basic Information | |
|---|---|
| Taxon OID | 3300028600 Open in IMG/M |
| Scaffold ID | Ga0265303_10192157 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1557 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: North Sea, Helgoland | |||||||
| Coordinates | Lat. (o) | 54.1817 | Long. (o) | 7.9018 | Alt. (m) | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049003 | Metagenome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265303_101921571 | F049003 | AGG | MSAEQDKRMALKQWLRGRLTEGEPPKEEWRQLLEATWDYLLLTPVRDLVDAKTAKAAADELMNAELVTELARPIVAAFAPVVIQELRGDERPLERFLPQGAQAKLQEAIARPGLVHPDWIRAMFRGEAAEAVLNDALYRALKDFSTLLPRLMVKVSPMGRLGVLGSAGAFAEKLIEDLERRIEPEIKSFLADRSDQILERAAEFTIAKLDDPASIEFRANLVNFVLSKSPAFLVGAADDALLDDIGAVAELTARHVADMPDVRADVHAWIDRAIEYAADMSLGESLHLQGIEARPPIDALAEATWPAFTALLRSPQAQHWMDTLLDELLDEYERIGDSEGVKGG |
| ⦗Top⦘ |