| Basic Information | |
|---|---|
| Taxon OID | 3300028590 Open in IMG/M |
| Scaffold ID | Ga0247823_10828403 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 694 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.673 | Long. (o) | -77.032 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029133 | Metagenome | 189 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247823_108284031 | F029133 | N/A | SLAQSTPFRGRTRYRSSEESPGQVSAGAEGIRRTVIARVLVAIDSADDLPLIDVACALADEHHASLEIVGGIARASFTVALVACPKALDDELECYSRTLLADAVERVPAHIPLVWRHIRGCARRQVLHMGADDMCLVLVGRLPWWARGALRRRVGRLVMLPDAPAPADGPPVALRERAGTLA |
| ⦗Top⦘ |