NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247828_10075334

Scaffold Ga0247828_10075334


Overview

Basic Information
Taxon OID3300028587 Open in IMG/M
Scaffold IDGa0247828_10075334 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1534
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081116Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0247828_100753343F081116N/AEWIMRISAQPPDEWLAMFQKDPGADAPGGSSWAVNVQFVELRLKSSPDTLPRAVEHVDERIRRANEGYRNWLNEAHRKGNERREGEIVEADRVRDLNERFKDL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.