 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300028576 Open in IMG/M |
| Scaffold ID | Ga0255340_1058709 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2060 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 3 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Associated Families | 3 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Vancouver, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.1150727 | Long. (o) | -123.147 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004383 | Metagenome / Metatranscriptome | 440 | Y |
| F005744 | Metagenome / Metatranscriptome | 391 | Y |
| F031138 | Metagenome / Metatranscriptome | 183 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255340_10587091 | F005744 | AGGAG | MDDERYEIIKAGASDAPPEQALYRIQQTYPDGSGGRLNIDWKGLLRVHELIHDRIALEGCVCETCSTRGCHRPATWEIECRGVGVASCLIYSCDDHCPDPAILSPQDEIRRIVVEE |
| Ga0255340_10587094 | F031138 | AGAAGG | MTKRNNYVGPCATACKPGAGTDTQNGTFDRILVAATEHAAREVGLPGRVDRETTYCRSCGCETTSGDGICAACAEALREERAAALDERCRIHRVRHVEDLPVSVLEEMQAEWGRC |
| Ga0255340_10587096 | F004383 | GGAG | MDPAECGHAVLPADDNLLERAFMARLRADEYRAELKALEEEFNDREDVIAIRRKIDRCEHERQTCIEQAKIAGVSKLGNYVLKIRTRKTRTVVPKLFFAKHGAEAFVECCTVAIGKAEALLGKAALDDC |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |