Scaffold Ga0247844_1183801

Overview

Basic Information

• Taxon OID: 3300028571
• Scaffold ID: Ga0247844_1183801
• Source Dataset Name: Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 810
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Spain: Castile-La Mancha
• Coordinates
  • Lat. (^o): 39.9879
  • Long. (^o): -1.8737
  • Depth (m): 14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005775	Metagenome	390	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0247844_11838011	F005775	N/A	MAKQRPIYTKAQHQIVTPAFVEKKIQLHKSIKWTTKDDRELFIMASGSVTRYVPKSDHNSQAPMGFFNLQMGHYNKISIHSRDFAQLADVFEQITLFLRNNANKLDTVVSKELDTYTTHHLTNLLNNGKQL