| Basic Information | |
|---|---|
| Taxon OID | 3300028571 Open in IMG/M |
| Scaffold ID | Ga0247844_1063685 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1966 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Castile-La Mancha | |||||||
| Coordinates | Lat. (o) | 39.9879 | Long. (o) | -1.8737 | Alt. (m) | Depth (m) | 14 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019102 | Metagenome | 231 | Y |
| F025225 | Metagenome | 202 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247844_10636852 | F019102 | N/A | MSISLEEELNSAFISPQKEFMGEKLAPYTEGSRLLLLQVRDDNDSSIYFIWSFIYVHILLTKNKKDAIKLCWNRDLFREKIMEYIEGKTEADREIATTIVSNILDEAQKGKVDVIPAPHQPDLGNA |
| Ga0247844_10636853 | F025225 | AGG | MITVELLNQAKFMHKLQQYQQVSKKNMADVINQKLGDVAVTAIGTTYRTNTAQIASELQRVEGQVVTKKVFKPFSLTKSGKVKKRKIGEYAVGFKAKSVNYAGTYKLVNWLLKNRGLATLGKTKVGVGGLGMGGGKPGTIGALARRLVAGRKRSVNYIRNGWAAAAAVFGKRASLTRGDYSKEAIKRLGGGTKADSKKSQMEGIIFNRAGDLDTRYYPVRKRPVSGAVKVGVPGLKMAIDKVMKDMNVYLARKNKEASDKLKL |
| ⦗Top⦘ |