| Basic Information | |
|---|---|
| Taxon OID | 3300028564 Open in IMG/M |
| Scaffold ID | Ga0255344_1125894 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1101 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Vancouver, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.1150727 | Long. (o) | -123.147 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045122 | Metagenome / Metatranscriptome | 153 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255344_11258941 | F045122 | N/A | GGITQNITNNYQHRIKGFEQLGGIVNKKDVHIKIVNGYISERSISNGYPIYQLRQNPKPFNSYKVEFQPDTNLYKKTIQFYFDGIGGANAKNVIDSLKDNEFMIVIERKENTYARNIFIGAQNGLHVTEMVEDEETGYWLVTMECEEPSAEISGFINMERFVNGEVV |
| Ga0255344_11258942 | F045122 | N/A | MSFTPCGGITQNITNNCQHRIKGFEQLGGIVNKKYTNILNIELGEIVSYSISNGFPIYQLRQNPKPFNSYKVEFQPDTNLYKKTIQFYFDGIGGANAKNVIDSLKDNEFMIVIERKEKLTYVDTFIFIGAQNGLHVTEMVEDEETGYWLITMETEEPAGEISGY |
| ⦗Top⦘ |