Basic Information | |
---|---|
Taxon OID | 3300028561 Open in IMG/M |
Scaffold ID | Ga0255343_1064258 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1767 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Vancouver, British Columbia | |||||||
Coordinates | Lat. (o) | 49.1150727 | Long. (o) | -123.147 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080199 | Metagenome / Metatranscriptome | 115 | N |
F088950 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255343_10642583 | F080199 | N/A | MNVKVYGAAETNLKLDKIVVAVQENLDNTIDLFTSDMTKEVKDSAPYDTGRYMSSWYYERVEPMTYAIISRNSDVRYNVFLVYGVSKFKPIAFEPRYKYADSERGIIHDIRQIKFIYSIKFAQLIKRTNLLSTGFAMAGL |
Ga0255343_10642584 | F088950 | GGCGG | MDIDGVLKELAAFIEEKVPELESKVTTIYPESNRFESPSVVIDIVSGREHLIIDGAKQYELVRIAIVSDRKSEINRIFKLITDAFLKYGRELTTGIYRGISYVSPVAPAFIEKNGVLKRELDIEIIEFMKVN |
⦗Top⦘ |