Scaffold Ga0255343_1030712

Overview

Basic Information

• Taxon OID: 3300028561
• Scaffold ID: Ga0255343_1030712
• Source Dataset Name: Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 3052
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 2
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Associated Families: 2

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium 34_109 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Vancouver, British Columbia
• Coordinates
  • Lat. (^o): 49.1150727
  • Long. (^o): -123.147
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021262	Metagenome / Metatranscriptome	219	N
F021489	Metagenome / Metatranscriptome	218	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255343_10307121	F021489	AGGAG	MTIEKKIESVQEYNLLKLLKANSSLKRFGVEWIKLDHNLCRAFTTNGYAIIVADLEPNQWHDIFDGLPELVFITKLKRDEVHYFEAKELEKFNYLSVFEAVGKDPNYQPVMHFDLKLLRNLTDKFDNIYFVKQSGLALFMKLEGDKYPAGSYYGALMPKTISQEETADIIEALSSLATDGEIRRQRVADLREFAQE
Ga0255343_10307126	F021262	N/A	MSKKYYIKFNTGKEVTGTAKEIVTQLRNESRLLAITPHKYAKLVAKSYEMSTGLKLRTWTYNSFVKSLGKSLMVMEFKEMK