| Basic Information | |
|---|---|
| Taxon OID | 3300028556 Open in IMG/M |
| Scaffold ID | Ga0265337_1000577 Open in IMG/M |
| Source Dataset Name | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 19283 |
| Total Scaffold Genes | 21 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (76.19%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 47.6516 | Long. (o) | -122.3045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069061 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265337_100057710 | F069061 | N/A | VIFDFKHKNADGKWESSGHHKGLTKDAAFASLEEKNGPMPSGRYMSRPRDGRSKNWDLFTRP |
| ⦗Top⦘ |