Scaffold Ga0213905_104811

Overview

Basic Information

• Taxon OID: 3300028551
• Scaffold ID: Ga0213905_104811
• Source Dataset Name: Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Shaw_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 623
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Gigasporaceae → Gigaspora → Gigaspora rosea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States

Source Dataset Sampling Location

• Location Name: USA: West Virginia
• Coordinates
  • Lat. (^o): 38.083
  • Long. (^o): -81.98
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002624	Metagenome / Metatranscriptome	542	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213905_1048111	F002624	N/A	MKSNNKYNGSNEYQKAIDFLEKGCNCGCSSRIPKEQFAELRESFQALSKPEQDIFLMAQIKAMDGGTVSASRRLKKKNRSNKRTFYHWDHN