| Basic Information | |
|---|---|
| Taxon OID | 3300028489 Open in IMG/M |
| Scaffold ID | Ga0257112_10314539 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 523 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Northeast Subartic Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007055 | Metagenome / Metatranscriptome | 359 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257112_103145391 | F007055 | GAGG | MSIIWIAIVLTWNPVIYTIDKEFSSEVDCWNYYDNGVGESKMLNSYGTQVLDHQGNKPDKEYMKKHRPAHREYPTRMYKNHGGWMV |
| ⦗Top⦘ |