NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257112_10135746

Scaffold Ga0257112_10135746


Overview

Basic Information
Taxon OID3300028489 Open in IMG/M
Scaffold IDGa0257112_10135746 Open in IMG/M
Source Dataset NameMarine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)882
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: Northeast Subartic Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044150Metagenome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0257112_101357462F044150AGGCGGMKICFASLRKRINYTDVLEYGMDVFYECFRYYKNNFFNKHHDFSYYNFAWGSKGAERNLDVIKNADIIIFPAVQEFIYFANAMHPRDVEKSQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.