Scaffold Ga0256397_1031692

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256397_1031692

Scaffold Ga0256397_1031692

Overview

Basic Information
Taxon OID	3300028436 Open in IMG/M
Scaffold ID	Ga0256397_1031692 Open in IMG/M
Source Dataset Name	Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	540
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	Mediterranean Sea
Coordinates	Lat. (^o)	34.9283	Long. (^o)	22.0216	Alt. (m)		Depth (m)	3337
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053776	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0256397_10316922	F053776	AGG	MNWSTKLRPQILAAMCLIAGLGALGCYVGLKMDASEIVTGALGATVSLIGVLGMKVLESESDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.