NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256397_1000697

Scaffold Ga0256397_1000697


Overview

Basic Information
Taxon OID3300028436 Open in IMG/M
Scaffold IDGa0256397_1000697 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2889
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.9283Long. (o)22.0216Alt. (m)Depth (m)3337
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005364Metagenome / Metatranscriptome403Y
F016882Metagenome / Metatranscriptome244Y
F053550Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0256397_10006973F005364AGGAMNKLDLQNKLRSLIEEEVQSVLAERSYKFGGLLDPDKFDPVDPEVHIVGFGTMVRSSLRREIVTRLEGAYKTAKSASAGGPSSYDKFKSLEGVLEDKGILMQQIKAEAEIANELEQLRTKGGRRAIPIPKQF
Ga0256397_10006976F016882N/AMYYTAKVKIAIDSPKGVKWNTETYLVNAVSVTHAESLVTEDFANDGIEFEVKSVSASQVIKVIGNTKKI
Ga0256397_10006978F053550N/AMKIDKNKKRVLKEYPDAYIDTMAGGIRVMNGDDFIAEEFYMPITTNVDTAWKYAALACKTAQNFNRTHPMRMELSEFESKYNRINNRKRRGRRNVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.