Scaffold Ga0256397_1000050

Overview

Basic Information

• Taxon OID: 3300028436
• Scaffold ID: Ga0256397_1000050
• Source Dataset Name: Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8125
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 34.9283
  • Long. (^o): 22.0216
  • Depth (m): 3337

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055650	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256397_10000506	F055650	N/A	VRREIHGWEINKKVNVNYKVNLSDVIKVGIFVAGLMGTWYSMKYSVDTLEVKVNKLERELEETNLGVIKNDIEYIKKGQDKTQDDLQQYYNAVNEFITVHTSDHD