NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228615_1174403

Scaffold Ga0228615_1174403


Overview

Basic Information
Taxon OID3300028418 Open in IMG/M
Scaffold IDGa0228615_1174403 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 16D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)540
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC031P(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002485Metagenome / Metatranscriptome555Y
F014447Metagenome263Y

Sequences

Protein IDFamilyRBSSequence
Ga0228615_11744031F002485GGAGGMKTQIDSKSLYFKNIGNNTVYYSYNTTVAIKTPIDTYVSENVWSVTTAKHLNRIEELTGSNREYRMKYKHFREFCINNNINKHYN
Ga0228615_11744032F014447N/AEITKHNYKAFGIQNNREFRKYKSRALKDLNSNSLIFQKYYKPVKSSIYNSINQSIQGGKSKNARYNHSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.