Scaffold Ga0256834_1009692

Overview

Basic Information

• Taxon OID: 3300028417
• Scaffold ID: Ga0256834_1009692
• Source Dataset Name: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - 4281-140
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4810
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8384
  • Long. (^o): -104.2913
  • Depth (m): 2510

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079616	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256834_10096927	F079616	AGG	MVNTFEIGEIVVCVNARRNWYKLGGLKRDEMYTVIGFNPYDKGLILKEVKSPGSGCHAYAAERFRKVDYNFAENIIEELQPQEEFQIIKS