Scaffold Ga0306866_1008765

Overview

Basic Information

• Taxon OID: 3300028410
• Scaffold ID: Ga0306866_1008765
• Source Dataset Name: Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1819
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Vogesella → Vogesella indigofera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Rauer Islands
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066321	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0306866_10087653	F066321	GGAG	MIIKIGRPDPAKARAAASMSRLDFAKLALREGWITSAEAKAWVPGNALPQIVTDIIAQHIEGADKQDIAEINALGQLVVNRNDLLLRLLMMSKKVTDAQMDTLFGIEP