Scaffold Ga0256832_1005461

Overview

Basic Information

• Taxon OID: 3300028400
• Scaffold ID: Ga0256832_1005461
• Source Dataset Name: Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 134-614
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8601
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Lau Basin
• Coordinates
  • Lat. (^o): -21.9879
  • Long. (^o): -176.5676
  • Depth (m): 1894

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039145	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256832_10054617	F039145	AGGAG	MKNFLTSVLVSLTLLTGCGQQPVNTPAELSPFIEKLKENGVDGTLLVRAPFNEDMEYVAEYEIARYASTRVISLFKFRDAEKAQENLQEALKNKKLSGQARNGSFIIAATFYPPDEEAVEKIKALFLAQKFE