| Basic Information | |
|---|---|
| Taxon OID | 3300028399 Open in IMG/M |
| Scaffold ID | Ga0256830_1089555 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1085 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: Lau Basin | |||||||
| Coordinates | Lat. (o) | -20.761 | Long. (o) | -176.1909 | Alt. (m) | Depth (m) | 2138 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032091 | Metagenome / Metatranscriptome | 181 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256830_10895552 | F032091 | N/A | IYDHLDLDIQYQHSDLFLDICKTVDEIDDERASLVLSYGHQMIEHIWMWTENIWSYYSNKNNPVPARTFDYYRD |
| ⦗Top⦘ |