Scaffold Ga0256830_1020677

Overview

Basic Information

• Taxon OID: 3300028399
• Scaffold ID: Ga0256830_1020677
• Source Dataset Name: Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3049
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Lau Basin
• Coordinates
  • Lat. (^o): -20.761
  • Long. (^o): -176.1909
  • Depth (m): 2138

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035771	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256830_10206771	F035771	N/A	LLLIQDAFLIGNVEKSRQRRSRRFAVLTYAAYAPPVKTAAALLDGLF