NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0304730_1022453

Scaffold Ga0304730_1022453


Overview

Basic Information
Taxon OID3300028394 Open in IMG/M
Scaffold IDGa0304730_1022453 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3395
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004010Metagenome / Metatranscriptome457Y
F011753Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0304730_10224531F011753N/AEKGLVGAGYAGRSDAYVRMKGVGDAMIDLKNRKVNPKYDPFYDTDCAQLWAYRAASENPQCACVSVVLASNDATKLTTKVWDEDELYQAGIAFCAMQKVWAWVKGYTPPGMKL
Ga0304730_102245311F004010AGGAGMLGKDVSKNMHELAMDNKKKGKARGAGGTPRSRQQMIAIALSAAGKSNKSPRKFRM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.