NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0304729_1123569

Scaffold Ga0304729_1123569


Overview

Basic Information
Taxon OID3300028392 Open in IMG/M
Scaffold IDGa0304729_1123569 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)858
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024095Metagenome / Metatranscriptome207Y
F058935Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0304729_11235691F024095GGCGGMDNTNSLPFVYVVNAVFGAGTLGASISTTLIMQADSRFELMGIMGTGGENQVTTEQSLFYPNSFTVSIRDQTTGRDLMSAPVPQRIMCGNAFQQFLEKRGIIFEPQSNLLFTFTNLTNVANTITLGLHGYKIIL
Ga0304729_11235692F058935N/AFIQCPPGFGIDIQSLATSRTGTAAETQVSGTSWSARPDYRAQSVYNIDPIQIIEPEIQIQAAINFPNGNTPSFSNSALTSDDTLFSPSVELGLIFDGYVIRPSQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.