| Basic Information | |
|---|---|
| Taxon OID | 3300028364 Open in IMG/M |
| Scaffold ID | Ga0306898_1023377 Open in IMG/M |
| Source Dataset Name | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #564 (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 859 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Rauer Islands | |||||||
| Coordinates | Lat. (o) | -68.5558 | Long. (o) | 78.1913 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0306898_10233772 | F015419 | N/A | MKYKITITDENGNDHLYNVSRSSSDEPKNLNDFILEALSISEDKRELPFMIQCPNGLEVHPSLKMKFENYGSSLLGDKLEAMHVTWRD |
| ⦗Top⦘ |