Scaffold Ga0306893_123649

Overview

Basic Information

• Taxon OID: 3300028348
• Scaffold ID: Ga0306893_123649
• Source Dataset Name: Saline lake microbial communities from Deep lake, Antarctica - Metagenome #293 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Deep lake
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026204	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0306893_1236492	F026204	AGGAG	MTDNIPLTDAPRALRAHGLSTTYNALWIAIVAGRVPAERFGKRWYVRAADLAVIAQILKK