Scaffold Ga0306893_112700

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0306893_112700

Scaffold Ga0306893_112700

Overview

Basic Information
Taxon OID	3300028348 Open in IMG/M
Scaffold ID	Ga0306893_112700 Open in IMG/M
Source Dataset Name	Saline lake microbial communities from Deep lake, Antarctica - Metagenome #293 (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	788
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Deep lake
Coordinates	Lat. (^o)	-68.5558	Long. (^o)	78.1913	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016628	Metagenome	245	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0306893_1127002	F016628	GAGG	MKTYSINIAKAYTQADWRGLPAHMHHALVTLDYGMSESEAVAELRRLETAYPWPEFHLTLTAVEIIRLAEKLYSSAPMDFLEAHQWDKLASTHEGD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.