| Basic Information | |
|---|---|
| Taxon OID | 3300028325 Open in IMG/M |
| Scaffold ID | Ga0268261_10359331 Open in IMG/M |
| Source Dataset Name | Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1258 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | laboratory colony in Florida, USA | |||||||
| Coordinates | Lat. (o) | 26.0625 | Long. (o) | -80.2332 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008366 | Metagenome | 334 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268261_103593311 | F008366 | N/A | LFPNWQKESWQTFEETSGYVRLERVNKWPNSMTDI |
| ⦗Top⦘ |