NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228617_1012955

Scaffold Ga0228617_1012955


Overview

Basic Information
Taxon OID3300028297 Open in IMG/M
Scaffold IDGa0228617_1012955 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 18D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3026
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019562Metagenome / Metatranscriptome229N
F084452Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0228617_10129551F084452GGAGMINKLIWNKIEELFYWNISVDSPINQLPFTMDFILACQKEFSMTVRDKEYPIHLGGIMDWHDKTMGDFVKEIDKQYQSNYFVAENGTSTTGVVGEIKDVNDKPITNKWNIRGDALVKRLQAMQKERPNLTILDMGCGVNEYKKHLNNVTGVDPYRKEADILCSQADFKPANDIKWDVIICFGPQNWYTYDEQYRNFMTLKNCLAPSGLLLWSHVHNYYKVFQPDHPHGHTWIHGDLEHAQ
Ga0228617_10129553F019562AGGMWYHKKFKLQYDTNVFNEIIEYAERATWRQGYDQNGLLWNVEELPLNPKQFPILNELYEGLNTEFKRPSFFISNVKPGGLVNHIDHNKWGNLGIPLKGDFENTPQYFYDQFNHPVESFVVDSPVIFNTRMLHAVPRQLTDTGPRWVLMMDLFEWVDKLFDKIDKKTIWTDTKNFKNA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.