NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257126_1010858

Scaffold Ga0257126_1010858


Overview

Basic Information
Taxon OID3300028287 Open in IMG/M
Scaffold IDGa0257126_1010858 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4827
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (64.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008747Metagenome / Metatranscriptome328Y

Sequences

Protein IDFamilyRBSSequence
Ga0257126_101085810F008747AGGVTAVGVPLIAPVEESKDKPTGSDGEADQEVIVPPLTVGVTVVIEVPFVNVNEFGL
Ga0257126_101085814F008747N/AEEEISVGVPLIAPVEVSKEMPAARAGDTDQEVTVPPLEVGVTDVIAVPLVSVNEFGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.