NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257120_1001702

Scaffold Ga0257120_1001702


Overview

Basic Information
Taxon OID3300028284 Open in IMG/M
Scaffold IDGa0257120_1001702 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14112
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (8.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001728Metagenome / Metatranscriptome645Y
F013571Metagenome / Metatranscriptome270Y
F047678Metagenome / Metatranscriptome149N

Sequences

Protein IDFamilyRBSSequence
Ga0257120_100170224F047678N/AMQINDKQIEKITGAIITSFVNLHFLEEVKASRLVKQKVKYNLKRTLNDLLEIENQYFDKIDNIDENNLSDKLVANKLEFVKWLLNKFDFNDFTKLQEVCTAYSLDPKKLTETSDSILEQNGAEIIK
Ga0257120_10017024F013571N/AMEINLILLVPDAMIVGWQYYRPDDNFKYSEINIFLFFGQLQIRWTKYE
Ga0257120_10017026F001728N/AMNSIVLKKTKKDYYRLILNGVDVTGEQERSVFRHILETVDNGIDK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.