| Basic Information | |
|---|---|
| Taxon OID | 3300028283 Open in IMG/M |
| Scaffold ID | Ga0268283_1090482 Open in IMG/M |
| Source Dataset Name | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 895 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Sakinaw lake, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.68 | Long. (o) | -124.009 | Alt. (m) | Depth (m) | 36 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001530 | Metagenome / Metatranscriptome | 676 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268283_10904822 | F001530 | GGTGG | MTITKDFLVAEISSLEQELQKAQVFNIQAQATIAAYKMLINKLDEPIEAELVNES |
| ⦗Top⦘ |