Basic Information | |
---|---|
Taxon OID | 3300028269 Open in IMG/M |
Scaffold ID | Ga0255193_1002279 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2971 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Louisiana | |||||||
Coordinates | Lat. (o) | 29.8571 | Long. (o) | -89.9778 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032278 | Metagenome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255193_10022793 | F032278 | N/A | MIKLTPSQITVDAAAADGLPRRSISGVAVTYDETATVSDGTRVRFLQGSLPVTGRDPKLFMQHDSTQIIGKLVERVDTPQGMMFTAKISATRLGDEALTLANDGVIDAVSV |
⦗Top⦘ |