| Basic Information | |
|---|---|
| Taxon OID | 3300028262 Open in IMG/M |
| Scaffold ID | Ga0268310_1027358 Open in IMG/M |
| Source Dataset Name | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 626 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.39 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000412 | Metagenome / Metatranscriptome | 1169 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268310_10273581 | F000412 | N/A | NRGIFSQTSSTCLERPYRKDSSGAHPCRAIDRAXEPRIPSPCSLKAITHATGSKIGSSRSYWNRSTEYYRVGMKTHIEYPHIFFXKYNSPYHIQMGTYVLIDLLXAGGSVAPAQQTSLRXNXGIFAQTCSTCLEGPYRKDLSSAHPCRAIDRAXEPRIPSPCSLKAIPHATGSEIGSSRSCWNRGTEYYPIGMKTHIEYPDIFFXKYN |
| ⦗Top⦘ |