Scaffold Ga0302102_11031673

Overview

Basic Information

• Taxon OID: 3300028242
• Scaffold ID: Ga0302102_11031673
• Source Dataset Name: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Alfalfa, Gen0, Rep 2, Chloramphenicol (v3)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 584
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4148
  • Long. (^o): -119.8405
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031319	Metagenome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302102_110316731	F031319	N/A	MFNEIDGSYDDVAISTFKAGLPADHDLRKSLTGKPVTSVRLLMDRIDKYRRIEED