Scaffold Ga0257121_1218438

Overview

Basic Information

• Taxon OID: 3300028198
• Scaffold ID: Ga0257121_1218438
• Source Dataset Name: Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 599
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004404	Metagenome / Metatranscriptome	439	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257121_12184383	F004404	AGGA	MDNENSKIGKLINGFNDYLDKLKQEEDHSLAIFYDYDIEPLKNDLTDMINEKNKREK