Scaffold Ga0257110_1352079

Overview

Basic Information

• Taxon OID: 3300028197
• Scaffold ID: Ga0257110_1352079
• Source Dataset Name: Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: Northeast Subartic Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030051	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257110_13520792	F030051	GGAG	MADPNTVGHFFENMTTAMVSIIIALIGFWTTFIKGLVSRKEVQEMIQNQSQYGRDREFIMDRLKDHKEDSATLFRALSKNTEVMSELKVQIALLS