NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257110_1020763

Scaffold Ga0257110_1020763


Overview

Basic Information
Taxon OID3300028197 Open in IMG/M
Scaffold IDGa0257110_1020763 Open in IMG/M
Source Dataset NameMarine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2925
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: Northeast Subartic Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076105Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0257110_10207633F076105N/AMREEKTERETMMMMFTTTRTKTTIKNRHRRFLQIAKKALNVVVFSVLLLLSQPRTVEAKRGDPDKPKYLPSTIYYSIRQAQQMCDMPLPKGHENDGAPLLPKARVQGRVDQRALHLCQQWNFVVANRQAQGKMQGYKLKPIIPPEHFHDGYVADMDKSAEYPEAAQAQNRLGYANGDEYDEEHMNMSREIHDASGHVGTGTGNAAAFADDVLLVAGAILFGAALKHVYDSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.