Basic Information | |
---|---|
Taxon OID | 3300028196 Open in IMG/M |
Scaffold ID | Ga0257114_1042867 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2045 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: British Columbia | |||||||
Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001746 | Metagenome / Metatranscriptome | 643 | Y |
F029744 | Metagenome / Metatranscriptome | 187 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257114_10428671 | F029744 | AGG | MEAIKKLRDKKIFNDQTIVESMIQKFWMGSPVLKRSLLRV |
Ga0257114_10428672 | F001746 | N/A | MRKHHNKLYYGKYRYKTTFKMPGSLMFYPTTDEHLNKLKQQYHDAPDINHLASFIMNNRKKLKFRMQDRRTIFYSDMDKAQELIERFWDFWVGSDTVDPKFNNLDTNTVGCSRLPHGKYHYQVYLKKGAQMHINDAQRSSLWEFLERNVDDCLVTNYNIIDFLEKKSAYCFGGYFYITEEKFLTPIYMMAQNAIDKVIKFRKVKNGSNKKVTR |
⦗Top⦘ |