NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265595_1158398

Scaffold Ga0265595_1158398


Overview

Basic Information
Taxon OID3300028191 Open in IMG/M
Scaffold IDGa0265595_1158398 Open in IMG/M
Source Dataset NameSaline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)694
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061534Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0265595_11583982F061534GGGGGMNDCGHIPPELMERVRGMFLTLFGGKEKLDCWLTRIADELADADNPANRPIRLDPSLIPEEFQSVMHRPKEVVDLIAERLESLSVFGYTAKIVKQGEVSLAIVSDQVSGHVIEEAAGPDPDNLIHSLVEKYGPNLEVVKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.